Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340626361
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004744813.1
Description putative polyketide synthase FADD33 [Mycobacterium canettii CIPT 14
Sequence MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLD
HDRPAAVGLVGEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADAT
LTRFLGIGVRTVLSQGSYLARLRSVDTAGVTIGDLSTAAHTNRSATPVAS
EGPAVLQGTAGSTGAPRTAILSPGAVLSNLRGLNQRVGTDAATDVGCSWL
PLYHDMGLAFVLSAALAGAPLWLAPTTAFTASPFRWLSWLSDSGATMTAA
PNFAYNLIGKYARRVSEVDLGALRVTLNGGEPVDCDGLTRFAEAMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPG
MEVRISCGDQAAGNASREIGEIEIRGASMMAGYLGQQPIDPDDWFATGDL
GYLGAGGLVVCGRAKEVISIAGRNIFPTEVELVAAQVRGVREGAVVALGT
GDRSTRPGLVVAAEFRGPDEANARAELIQRVASECGIVPSDVVFVSPGSL
PRTSSGKLRRLAVRRSLEMAD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)37
MHC class II prediction (Propred)75
MHC class 1 prediction (Propred1)355
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)214
Prediction of IL4 inducing peptides (IL4pred)316