Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340627712
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004746164.1
Description iron-dependent repressor and activator IDER [Mycobacterium canettii
Sequence MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDAN
LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETT
PGGGVTIVIPGHENVTLPHEMAHAVKVEKV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)9
Vaccine TargetYes
B cell prediction (LBtope)14
MHC class II prediction (Propred)31
MHC class 1 prediction (Propred1)146
CTL epitope prediction (CTLpred)33
Prediction of interferon-gamma inducing peptides (IFNepitope)84
Prediction of IL4 inducing peptides (IL4pred)131