Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340627746
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004746198.1
Description putative transcriptional regulatory protein [Mycobacterium canettii
Sequence MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSS
ELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTK
VVIAPVVSLAVA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)4
MHC class II prediction (Propred)15
MHC class 1 prediction (Propred1)75
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)29
Prediction of IL4 inducing peptides (IL4pred)72