Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID340628109
StrainM_canettii_CIPT_140010059_3861
Protein IDYP_004746561.1
Description two component transcriptional regulatory protein [Mycobacterium can
Sequence MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAARPDV
AVLDVRLPDGNGIELCRDLLSRMPDLRCLILTSYTSDEAMLDAILAGASG
YVVKDIKGMELARAVKDVGAGRSLLDNRAAAALMAKLRGAAEKQDPLSGL
TDQERTLLGLLSEGLTNKQIADRMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFATELKRSRPPGDGP
B cell epitope (IEDB)1
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)26
MHC class 1 prediction (Propred1)149
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)98
Prediction of IL4 inducing peptides (IL4pred)128