Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID375297280
StrainMtb_KZN_4207-3996
Protein IDYP_005101547.1
Description unnamed protein product [Mycobacterium tuberculosis KZN 4207]
Sequence MSPSTSIEALDQPVKPVVFRPLTLRRRIKNSVATTFFFTSFVVALIPLVW
LLWVVIARGWFAVTRSGWWTHSLRGVLPEQFAGGVYHALYGTLVQAGVAA
VLAVPLGLMTAVYLVEYGTGRMSRVTTFTVDVLAGVPSIVAALFVFSLWI
ATLGFQQSAFAVALALVLLMLPVVVRAGEEMLRLVPDELREASYALGVPK
WKTIVRIVAPIAMPGIVSGILLSIARVVGETAPVLVLVGYSHSINLDVFH
GNMASLPLLIYTELTNPEHAGFLRVWGAALTLIIVVATINLAAAMIRFVA
TRRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)8
Vaccine TargetYes
B cell prediction (LBtope)9
MHC class II prediction (Propred)81
MHC class 1 prediction (Propred1)234
CTL epitope prediction (CTLpred)87
Prediction of interferon-gamma inducing peptides (IFNepitope)127
Prediction of IL4 inducing peptides (IL4pred)188