Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID378770515
StrainM_bovis_BCG_str_Mexico
Protein IDYP_005170248.1
Description phoP gene product [Mycobacterium bovis BCG str. Mexico]
Sequence MRKGVDLVTAGTPGENTTPEARVLVVDDEANIVELLSVSLKFQGFEVYTA
TNGAQALDRARETRPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTA
RDSLQDKIAGLTLGGDDYVTKPFSLEEVVARLRVILRRAGKGNKEPRNVR
LTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILD
HVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)161
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)84
Prediction of IL4 inducing peptides (IL4pred)164