Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID378770693
StrainM_bovis_BCG_str_Mexico
Protein IDYP_005170426.1
Description pstS1 gene product [Mycobacterium bovis BCG str. Mexico]
Sequence MKIRLHTLLAVLTAAPLLLAAAGCGSKPPSGSPETGAGAGTVATTPASSP
VTLAETGSTLLYPLFNLWGPAFHERYPNVTITAQGTGSGAGIAQAAAGTV
NIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVL
AAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLS
KQDPEGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGI
SFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLD
QAHFQPLPPAVVKLSDALIATISS
B cell epitope (IEDB)36
T cell epitope (IEDB)121
MHC binder (IEDB)56
Vaccine TargetYes
B cell prediction (LBtope)59
MHC class II prediction (Propred)46
MHC class 1 prediction (Propred1)232
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)112
Prediction of IL4 inducing peptides (IL4pred)221