Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID378771282
StrainM_bovis_BCG_str_Mexico
Protein IDYP_005171015.1
Description pks5 gene product [Mycobacterium bovis BCG str. Mexico]
Sequence MGKERTKTVDRTRVTPVAVIGMGCRLPGGIDSPDRLWEALLRGDDLVTEI
PADRWDIDEYYDPEPGVPGRTDCKWGAYLDNVGDFDPEFFGIGEKEAIAI
DPQHRLLLETSWEAMEHGGLTPNQMASRTGVFVGLVHTDYILVHADNQTF
EGPYGNTGTNACFASGRVAYAMGLQGPAITVDTACSSGLTAIHLACRSLH
DGESDIALAGGVYVMLEPRRFASGSALGMLSATGRCHAFDVSADGFVSGE
GCVMLALKRLPDALADGDRILAVIRGTAANQDGHTVNIATPSRSAQVAAY
REALDVAGVDPATVGMVEAHGPGTPVGDPIEYASLAEVYGNDGPCALASV
KTNFGHTQSAAGALGLMKAVLALQHGVVPQNLHFTALPDKLAAIETNLFV
PQEITPWPGADQETPRRAAVSSYGMTGTNVHAIVEQAPVPAPESGAPGDT
PATPGIDGALLFALSASSQDALRQTAARLADWVDAQGPELAPADLAYTLA
RRRGHRPVRTAVLAATTAELTEALREVATGETPYPPAVGQDDRGPVWVFS
GQGSQWAGMGADLLATEPVFAATIAAIEPLIAAESGFSVTEAMTAPEVVT
GIDRVQPTLFAMQVALAATMKSYGVAPGAVIGHSLGESAAAVVAGALCLE
DGVRVICRRSALMTRIAGAGAMASVELPAQQVLSELMARGVNDAVVAVVA
SPQSTVIGGATQTVRDLVAAWEQRDVLAREVAVDVASHSPQVDPILDELA
EALAEISPLQPEIPYYSATSFDPREEPYCDAYYWVDNLRHTVRFAAAVQA
ALEDGYRVFTELTPHPLLTHAVDQTARSLDMSAAALAGMRREQPLPHGLR
ALAGDLYAAGAAVDFAVLYPTGRLINAPLPTWNHRRLLLDDTTRRIAHAN
TVAVHPLLGSHVRLPEEPERHVWQGEVGTVTQPWLADHQIHGAAALPGAA
YCEMALAAARAVLGEASEVRDIRFEQMLLLDDETPIGVTATVEAPGVVPL
TVETSHDGRYTRQLAAVLHVVREADDAPDQPPQKNIAELLASHPHKVDGA
EVRQWLDKRGHRLGPAFAGLVDAYIAEGAGDTVLAEVNLPGPLRSQVKAY
GVHPVLLDACFQSVAAHPAVQGMADGGLLLPLGVRRLRSYGSARHARYCC
TTVTACGVGVEADLDVLDEHGAVVLAVRGLQLGTGASQASERARVLGERL
LSIEWHERELPENSHAEPGAWLLISTCDATDLVAAQLTDALKVHDAQCTT
MSWPQRADHAAQAARLRDQLGTGGFTGVFVLTAPQTGDPDAESPVRGGEL
VKHVVRIAREIPEITAQEPRLYVLTHNAQAVLSGDRPNLEQGGMRGLLRV
IGAEHPHLKASYVDVDEQTGAESVARQLLAASGEDETAWRNDQWYTARLC
PAPLRPEERQTTVVDHAEAGMRLQIRTPGDLQTLEFAALDRVPPGPGEIE
VAVTASSINFADVLVTFGRYQTLDGRQPQLGTDFAGVVSAVGPGVSELKV
GDRVGGMSPNGCWATFVTCDARLATRLPEGLTDAQAAAVTTASATAWYGL
QDLARIKAGDKVLIHSATGGVGQAAIAIARAAGAQIYATAGNEKRRDLLR
DMGIEHVYDSRSVEFAEQIRRDTAGYGVDIVLNSVTGAAQLAGLKLLALG
GRFIEIGKRDIYSNTRLELLPFRRNLAFYGLDLGLMSVSHPAAVRELLST
VYRLTVEGVLPMPQSTHYPLAEAATAIRVMGAAEHTGKLILDVPHAGRSS
VVLPPEQARVFRSDGSYIITGGLGGLGLFLAEKMANAGAGRIVLSSRSQP
SQKALETIELVRAIGSDVVVECGDIAQPDTADRLVTAATATGLPLRGVLH
AAAVVEDATLANITDELIERDWAPKAYGAWQLHRATADQPLDWFCSFSSA
AALVGSPGQGAYAAANSWLDTFTHWRRAQDLPATSIAWGAWGQIGRAIAF
AEQTGDAIAPEEGAYAFETLLRHNRAYSGYAPVIGSPWLTAFAQHSPFAE
KFQSLGQNRSGTSKFLAELVDLPREEWPDRLRRLLSKQVGLILRRTIDTD
RLLSEYGLDSLSSQELRARVEAETGIRISATEINTTVRGLADLMCDKLAA
DRDAPAPA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)168
MHC class II prediction (Propred)278
MHC class 1 prediction (Propred1)1429
CTL epitope prediction (CTLpred)311
Prediction of interferon-gamma inducing peptides (IFNepitope)820
Prediction of IL4 inducing peptides (IL4pred)1404