Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306406
StrainMtb_RGTB327
Protein IDYP_005359217.1
Description two component sensorY transduction protein [Mycobacterium tuberculo
Sequence MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)37
MHC class 1 prediction (Propred1)155
CTL epitope prediction (CTLpred)41
Prediction of interferon-gamma inducing peptides (IFNepitope)67
Prediction of IL4 inducing peptides (IL4pred)168