Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383306871
StrainMtb_RGTB327
Protein IDYP_005359682.1
Description hypothetical protein MRGA327_06225 [Mycobacterium tuberculosis RGTB
Sequence MAESSLNPSLVSRISAFLRPDWTRTVRARRFAAAGLVMLAGVAALRSNPE
DDRSEVVVAAQDLRPGTALTPGDVRLEKRSATTLPDGSQADLDAVVGSTL
ASPTRRGEVLTDVRLLGSRLAESTAGPDARIVPLHLADSALVDLVRVGDV
VDVLAAPVTDSPAALRLLATDAIVVLVSAQQKAQAADSDRVVLVALPARL
ANTVAGAALGQTVTLTLH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)8
MHC class II prediction (Propred)32
MHC class 1 prediction (Propred1)155
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)67
Prediction of IL4 inducing peptides (IL4pred)86