Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307129
StrainMtb_RGTB327
Protein IDYP_005359940.1
Description TetR family transcriptional regulator [Mycobacterium tuberculosis R
Sequence MAGTDWLSARRTELAADRILDAAERLFTQRDPASIGMNEIAKAAGCSRAT
LYRYFDSREALRTAYVHRETRRLGREIMVKIADVVEPAERLLVSITTTLR
MVRDNPALAAWFTTTRPPIGGEMAGRSEVIAALAAAFLNSLGPDDPTTVE
RRARWVVRMLTSLLMFPGRDEADERAMIAEFVVPIVTPASAAARKAGHPG
PE
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)22
MHC class II prediction (Propred)33
MHC class 1 prediction (Propred1)142
CTL epitope prediction (CTLpred)38
Prediction of interferon-gamma inducing peptides (IFNepitope)94
Prediction of IL4 inducing peptides (IL4pred)113