Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307130
StrainMtb_RGTB327
Protein IDYP_005359941.1
Description cytochrome P450 [Mycobacterium tuberculosis RGTB327]
Sequence MSHEFQLATAETWPNPWPMYRALRDHDPVHHVVPPQRPEYDYYVLSRHAD
VWSAARDHQTFSSAQGLTVNYGELEMIGLHDTPPMVMQDPPVHTEFRKLV
SRGFTPRQVETVEPTVRKFVVERLEKLRANGGGDIVTELFNPLPSMVVAH
YLGVPEEDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTGLIERR
RTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVTGMLGG
SMPLLHRRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTRDVTIG
DTTIPAGRRVLLLYGSANRDERQYGPDAAELDVTRCPRNILTFSHGAHHC
LGAAAARMQCRVALTELLARCPDFEVAESRIVWSGGSYVRRPLSVPFRVT
S
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)33
MHC class II prediction (Propred)54
MHC class 1 prediction (Propred1)266
CTL epitope prediction (CTLpred)59
Prediction of interferon-gamma inducing peptides (IFNepitope)154
Prediction of IL4 inducing peptides (IL4pred)268