Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383307944
StrainMtb_RGTB327
Protein IDYP_005360755.1
Description undecaprenyl pyrophosphate phosphatase [Mycobacterium tuberculosis
Sequence MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLG
TEAAVVIYFARDIVRILSAWLHGLVVKAHRNTDYRLGWYVIIGTIPICIL
GLFFKDDIRSGVRNLWVVVTALVVFSGVIALAEYVGRQSRHIERLTWRDA
VVVGIAQTLALVPGVSRSGSTISAGLFLGLDRELAARFGFLLAIPAVFAS
GLFSLPDAFHPVTEGMSATGPQLLVATLIAFVLGLTAVAWLLRFLVRHNM
YWFVGYRVLVGTGMLVLLATGTVAAT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)210
CTL epitope prediction (CTLpred)70
Prediction of interferon-gamma inducing peptides (IFNepitope)112
Prediction of IL4 inducing peptides (IL4pred)148