Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308140
StrainMtb_RGTB327
Protein IDYP_005360951.1
Description phospholipase C 3 plcC [Mycobacterium tuberculosis RGTB327]
Sequence MSQGAFAGMSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLTD
IEHIVLCLQENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTG
ITLPYRINTTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQARTR
SVANTPVVMGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWIS
ATVNPDGDQGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLLG
GLNDTSLSRNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLPQ
VSWVVPLTVESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDE
HGGFFDHVTPLTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCF
VISPYSRGGLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTSA
FNFAAPPDPSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQTT
PVQESGPARPIPSGIC
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)138
MHC class II prediction (Propred)128
MHC class 1 prediction (Propred1)653
CTL epitope prediction (CTLpred)136
Prediction of interferon-gamma inducing peptides (IFNepitope)359
Prediction of IL4 inducing peptides (IL4pred)719