Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308227
StrainMtb_RGTB327
Protein IDYP_005361038.1
Description mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonucl
Sequence MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY
AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAP
GTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)19
MHC class 1 prediction (Propred1)84
CTL epitope prediction (CTLpred)19
Prediction of interferon-gamma inducing peptides (IFNepitope)58
Prediction of IL4 inducing peptides (IL4pred)88