Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308467
StrainMtb_RGTB327
Protein IDYP_005361278.1
Description RNA polymerase sigma factor [Mycobacterium tuberculosis RGTB327]
Sequence MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRA
TKPAARSVKPASAPQDTTTSTIPKRKTRAAAKSAAAKAPSARGHATKPRA
PKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLED
DVAPDADDDLDSGDDEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASG
DFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELA
KRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANL
RLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWW
IRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDA
VSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTR
ERIRQIESKTMSKLRHPSRSQVLRDYLD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)46
MHC class II prediction (Propred)52
MHC class 1 prediction (Propred1)342
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)196
Prediction of IL4 inducing peptides (IL4pred)286