Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383308691
StrainMtb_RGTB327
Protein IDYP_005361502.1
Description putative polyketide synthase [Mycobacterium tuberculosis RGTB327]
Sequence MIEEQRTMSVEGADQQSEKLFHYLKKVAVELDETRARLREYEQRATEPVA
VVGIGCRFPGAAWMARTDSGMSFRRGGDVVSEFPTDRGWDVEGLYDPDPD
AEGKTYTRWGAFLDDATGFDAGFFGIAPSEVLAMDPQQRLMLEVSWEALE
HAGIDPLSLRGSATGVYTGIFAASYGNRDTGGLQGYGLTGTSISVASGRV
SYVLGLQGPAVSVDTACSSSLVAIHWAMSSLRSGECDLALAGGVTVMGLP
SIFVGFSRQRGLAADGRCKAFAAAADGTGWGEGAGVVVLERLSDARRLGH
SVLAVVRGSAVNQDGASNGLTAPNGLAQQRVIQAALANAGLSAADVDVVE
AHGTATTLGDPIEAQALLSTYGQGGPAEQPLWVGSIKSNMGHTQAAAGVA
GVIKMVQAMRHGVMPATLHVDEPSPRVDWTSGAVSVLTEAREWSVDGRPR
RAAVSSFGISGTNAHLILEEAPVPAPAEAPVEASESTGGRGRRWCRG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)42
MHC class II prediction (Propred)61
MHC class 1 prediction (Propred1)320
CTL epitope prediction (CTLpred)71
Prediction of interferon-gamma inducing peptides (IFNepitope)255
Prediction of IL4 inducing peptides (IL4pred)332