Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309141
StrainMtb_RGTB327
Protein IDYP_005361952.1
Description putative cholesterol oxidase [Mycobacterium tuberculosis RGTB327]
Sequence MKPDYDVLIIGSGFGGSVTALRLTEKGYRVGVLEAGRRFSDEEFAKTSWD
LRKFLWAPRLGCYGIQRIHPLRNVMILAGAGVGGGSLNYANTLYVPPEPF
FADQQWSHITDWRGELMPHYQQAQRMLGVVQNPTFTDADRIVKEVADEMG
FGDTWVPTPVGVFFGPDGTKTPGKTVPDPYFGGAGPARTGCLECGCCMTG
CRHGAKNTLVKNYLGLAESAGAQVIPMTTVKGFERRSDGLWEVRTVRTGS
WLRRDRRTFTATQLVLAAGTWGTQHLLFKMRDRGRLPGLSKRLGVLTRTN
SESIVGAATLKVNPDLDLTHGVAITSSIHPTADTHIEPVRYGKGSNAMGL
LQTLMTDGSGPQGTDVPRWRQLLQTASQDPRGTIRMLNPRQWSERTVIAL
VMQHLDNSITTFTKRGKLGIRWYSSKQGHGEPNPTWIPIGNQVTRRIAAK
IDGVAGGTWGELFNIPLTAHFLGGAVIGDDPEHGVIDPYHRVYGYPTLYV
VDGAAISANLGVNPSLSIAAQAERAASLWPNKGETDRRPPQGEPYRRLAP
IQPAHPVVPADAPGALRWLPIDPVSNAG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)45
MHC class II prediction (Propred)92
MHC class 1 prediction (Propred1)374
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)240
Prediction of IL4 inducing peptides (IL4pred)402