Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309342
StrainMtb_RGTB327
Protein IDYP_005362153.1
Description hypothetical protein MRGA327_22270 [Mycobacterium tuberculosis RGTB
Sequence MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQ
FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG
LFT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)15
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)139
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)38
Prediction of IL4 inducing peptides (IL4pred)107