Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID383309581
StrainMtb_RGTB327
Protein IDYP_005362392.1
Description hypothetical protein MRGA327_23830 [Mycobacterium tuberculosis RGTB
Sequence MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAM
LGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINA
DRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRP
ANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWV
VKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHP
PDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLS
DLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGS
AYRIRVHVDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITG
TILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFG
HELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMT
HPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTG
ELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDE
FAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNL
TYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFY
ISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)67
MHC class II prediction (Propred)117
MHC class 1 prediction (Propred1)509
CTL epitope prediction (CTLpred)107
Prediction of interferon-gamma inducing peptides (IFNepitope)287
Prediction of IL4 inducing peptides (IL4pred)506