Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385990431
StrainMtb_CCDC5180
Protein IDYP_005908729.1
Description two component response transcriptional regulatory protein MprA [Myc
Sequence MSVRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDAL
VLDVMMPRLDGLEVCRQLRGTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTKPEDAAESMAMRFSDLTLDPVTREVNRGQ
RRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVG
YLRRKTEADGEPRLIHTVRGVGYVLRETPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)20
MHC class II prediction (Propred)42
MHC class 1 prediction (Propred1)159
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)80
Prediction of IL4 inducing peptides (IL4pred)152