Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385990931
StrainMtb_CCDC5180
Protein IDYP_005909229.1
Description nucleotide-sugar epimerase epiA [Mycobacterium tuberculosis CCDC518
Sequence MNAHTSVGPLDRAARVYIAGHRGLVGSALLRTFAGAGFTNLLVRSRAELD
LTDRAATFDFVLESRPQVVIDAAARVGGILANDTYPADFLSENLQIQVNL
LDAAVAARVPRLLFLGSSCIYPKLAPQPIPESALLTGPLEPTNDAYAIAK
IAGILAVQAVRRQHGLPWISAMPTNLYGPGDNFSPSGSHLLPALIRRYDE
AKASGAPNVTNWGTGTPRRELLHVDDLASACLYLLEHFDGPTHVNVGTGI
DHTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAGWRPSI
ALRDGIEATVAWYREHAGTVRQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)9
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)220
CTL epitope prediction (CTLpred)48
Prediction of interferon-gamma inducing peptides (IFNepitope)112
Prediction of IL4 inducing peptides (IL4pred)204