Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385991426
StrainMtb_CCDC5180
Protein IDYP_005909724.1
Description precorrin-6y methyltransferase cobL [Mycobacterium tuberculosis CCD
Sequence MIIVVGIGADGMTGLSGHSRSELRRATVIYGSKRQLALLDDTVTAERWEW
PTPMLPAVQGLSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVLPHV
SAVTLACARMGWNVYDTEVISLVTAQPHTAVRRGGRAIVLSGDRSTPQAL
AVLLTEHGRGDSKFSVLEQLGGPAERRRDGTARAWACDPPLDVDELNVIA
VRYLPDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRPGQRLWDVGAG
SGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA
FDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAH
AYSRLGGELRRFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)29
MHC class II prediction (Propred)54
MHC class 1 prediction (Propred1)248
CTL epitope prediction (CTLpred)63
Prediction of interferon-gamma inducing peptides (IFNepitope)154
Prediction of IL4 inducing peptides (IL4pred)225