Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385991708
StrainMtb_CCDC5180
Protein IDYP_005910006.1
Description phenyloxazoline synthase mbtB [Mycobacterium tuberculosis CCDC5180]
Sequence MVHATACSEIIRAEVAELLGVRADALHPGANLVGQGLDSIRMMSLVGRWR
RKGIAVDFATLAATPTIEAWSQLVSAGTGVAPTAVAAPGDAGLSQEGEPF
PLAPMQHAMWVGRHDHQQLGGVAGHLYVEFDGARVDPDRLRAAATRLALR
HPMLRVQFLPDGTQRIPPAAGSRDFPISVADLRHVAPDVVDQRLAGIRDA
KSHQQLDGAVFELALTLLPGERTRLHVDLDMQAADAMSYRILLADLAALY
DGREPPALGYTYREYRQAIEAEETLPQPVRDADRDWWAQRIPQLPDPPAL
PTRAGGERDRRRSTRRWHWLDPQTRDALFARARARGITPAMTLAAAFANV
LARWSASSRFLLNLPLFSRQALHPDVDLLVGDFTSSLLLDVDLTGARTAA
ARAQAVQEALRSAAGHSAYPGLSVLRDLSRHRGTQVLAPVVFTSALGLGD
LFCPDVTEQFGTPGWIISQGPQVLLDAQVTEFDGGVLVNWDVREGVFAPG
VIDAMFTHQVDELLRLAAGDDAWDAPSPSALPAAQRAVRAALNGRTAAPS
TEALHDGFFRQAQQQPDAPAVFASSGDLSYAQLRDQASAVAAALRAAGLR
VGDTVAVLGPKTGEQVAAVLGILAAGGVYLPIGVDQPRDRAERILATGSV
NLALVCGPPCQVRVPVPTLLLADLLAAAPAEFVPGPSDPTALAYVLFTSG
STGEPKGVEVAHDAAMNTVETFIRHFELGAADRWLALATLECDMSVLDIF
AALRSGGAIVVVDEAQRRDPDAWARLIDTYEVTALNFMPGWLDMLLEVGG
GRLSSLRAVAVGGDWVRPDLARRLQVQAPSARFAGLGGATETAVHATIFE
VQDAANLPPDWASVPYGVPFPNNACRVVADSGDDCPDWVAGELWVSGRGI
ARGYRGRPELTAERFVEHDGRTWYRTGDLARYWHDGTLEFVGRADHRVKI
SGYRVELGEIEAALQRLPGVHAAAATVLPGGSDVLAAAVCVDDAGVTAES
IRQQLADLVPAHMIPRHVTLLDRIPFTDSGKIDRAEVGALLAAEVERSGD
RSAPYAAPRTVLQRALRRIVADILGRANDAVGVHDDFFALGGDSVLATQV
VAGIRRWLDSPSLMVADMFAARTIAALAQLLTGREANADRLELVAEVYLE
IANMTSADVMAALDPIEQPAQPAFKPWVKRFTGTDKPGAVLVFPHAGGAA
AAYRWLAKSLVANDVDTFVVQYPQRADRRSHPAADSIEALALELFEAGDW
HLTAPLTLFGHCMGAIVAFEFARLAERNGVPVRALWASSGQAPSTVAASG
PLPTADRDVLADMVDLGGTDPVLLEDEEFVELLVPAVKADYRALSGYSCP
PDVRIRANIHAVGGNRDHRISREMLTSWETHTSGRFTLSHFDGGHFYLND
HLDAVARMVSADVR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)112
MHC class II prediction (Propred)190
MHC class 1 prediction (Propred1)964
CTL epitope prediction (CTLpred)259
Prediction of interferon-gamma inducing peptides (IFNepitope)603
Prediction of IL4 inducing peptides (IL4pred)899