Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385991762
StrainMtb_CCDC5180
Protein IDYP_005910060.1
Description nucleoside diphosphate kinase ndkA [Mycobacterium tuberculosis CCDC
Sequence MLGTVTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELA
SQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQ
AAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)16
MHC class II prediction (Propred)20
MHC class 1 prediction (Propred1)88
CTL epitope prediction (CTLpred)20
Prediction of interferon-gamma inducing peptides (IFNepitope)58
Prediction of IL4 inducing peptides (IL4pred)89