Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385992976
StrainMtb_CCDC5180
Protein IDYP_005911274.1
Description 19 kDa lipoprotein antigen precursor LPQH [Mycobacterium tuberculos
Sequence MKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGP
KVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSV
GLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNK
SFEIEVTCS
B cell epitope (IEDB)37
T cell epitope (IEDB)141
MHC binder (IEDB)27
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)11
MHC class 1 prediction (Propred1)89
CTL epitope prediction (CTLpred)12
Prediction of interferon-gamma inducing peptides (IFNepitope)29
Prediction of IL4 inducing peptides (IL4pred)101