Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385996284
StrainMtb_CCDC5079
Protein IDYP_005914582.1
Description RNA polymerase sigma factor SigD [Mycobacterium tuberculosis CCDC50
Sequence MVDPGVSPGCVRFVTLEISPSMTMQGERLDAVVAEAVAGDRNALREVLET
IRPIVVRYCRARVGTVERSGLSADDVAQEVCLATITALPRYRDRGRPFLA
FLYGIAAHKVADAHRAAGRDRAYPAETLPERWSADAGPEQMAIEADSVTR
MNELLEILPAKQREILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALQR
LKDEIVAAGDYA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)11
MHC class II prediction (Propred)35
MHC class 1 prediction (Propred1)155
CTL epitope prediction (CTLpred)35
Prediction of interferon-gamma inducing peptides (IFNepitope)88
Prediction of IL4 inducing peptides (IL4pred)150