Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385996478
StrainMtb_CCDC5079
Protein IDYP_005914776.1
Description epoxide hydrolase EphA [Mycobacterium tuberculosis CCDC5079]
Sequence MGAPTERLVDTNGVRLRVVEAGEPGAPVVILAHGFPELAYSWRHQIPALA
DAGYHVLAPDQRGYGGSSRPEAIEAYDIHRLTADLVGLLDDVGAERAVWV
GHDWGAVVVWNAPLLHADRVAAVAALSVPALPRAQVPPTQAFRSRFGENF
FYILYFQEPGIADAELNGDPARTMRRMIGGLRPPGDQSAAMRMLAPGPDG
FIDRLPEPAGLPAWISQEELDHYIGEFTRTGFTGGLNWYRNFDRNWETTA
DLAGKTISVPSLFIAGTADPVLTFTRTDRAAEVISGPYREVLIDGAGHWL
QQERPGEVTAALLEFLTGLELR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)46
MHC class 1 prediction (Propred1)205
CTL epitope prediction (CTLpred)47
Prediction of interferon-gamma inducing peptides (IFNepitope)133
Prediction of IL4 inducing peptides (IL4pred)200