Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID385997067
StrainMtb_CTRI-2
Protein IDYP_005915365.1
Description unnamed protein product [Mycobacterium tuberculosis CTRI-2]
Sequence MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFG
FWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLP
LTLIARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQAR
SARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRG
MRHTDSDYVAAYRVSADAELPDTLPAIRSRPAQETWIALEIAYAAGSSTR
YTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHT
DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)57
MHC class 1 prediction (Propred1)237
CTL epitope prediction (CTLpred)68
Prediction of interferon-gamma inducing peptides (IFNepitope)165
Prediction of IL4 inducing peptides (IL4pred)212