Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386000059
StrainMtb_CTRI-2
Protein IDYP_005918358.1
Description ctpC gene product [Mycobacterium tuberculosis CTRI-2]
Sequence MTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTG
SVVVWYSPRRADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMV
IGGVALALLGVRRYVFARPPLLGTTGRTVATGVTIFTGYPFLRGALRSLR
SGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRA
ISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVQIGDEVVVHEHVAI
PVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLIT
GDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAG
RVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPL
AEAVIRSTEERRISIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLRAEK
VRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAQVLTK
LRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
DGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHR
LLDVGDLGERAVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNAS
SVAVVANSSRLIRYRLDR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)62
MHC class II prediction (Propred)125
MHC class 1 prediction (Propred1)512
CTL epitope prediction (CTLpred)153
Prediction of interferon-gamma inducing peptides (IFNepitope)336
Prediction of IL4 inducing peptides (IL4pred)417