Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386000075
StrainMtb_CTRI-2
Protein IDYP_005918374.1
Description sigF gene product [Mycobacterium tuberculosis CTRI-2]
Sequence MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPL
ADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAE
LGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQI
ENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLA
KSLARLRDQLE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)21
MHC class II prediction (Propred)35
MHC class 1 prediction (Propred1)177
CTL epitope prediction (CTLpred)49
Prediction of interferon-gamma inducing peptides (IFNepitope)127
Prediction of IL4 inducing peptides (IL4pred)185