Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 386000209 |
| Strain | Mtb_CTRI-2 |
| Protein ID | YP_005918508.1 |
| Description | whiB3 gene product [Mycobacterium tuberculosis CTRI-2] |
| Sequence | MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAK EMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRR TA |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 13 |
| MHC class II prediction (Propred) | 8 |
| MHC class 1 prediction (Propred1) | 65 |
| CTL epitope prediction (CTLpred) | 16 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
| Prediction of IL4 inducing peptides (IL4pred) | 74 |