Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386005012
StrainMtb_RGTB423
Protein IDYP_005923291.1
Description RNA polymerase sigma factor SigC [Mycobacterium tuberculosis RGTB42
Sequence MTATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSA
DDLTQETFLRAIGAIPRFSARSSARTWLLAIARHVVADHIRHVRSRPRTT
RGARPEHLIDGDRHARGFEDLVEVTTMIADLTTDQREALLLTQLLGLSYA
DAAAVCGCPVGTIRSRVARARDALLADAEPDDLTG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)10
MHC class II prediction (Propred)21
MHC class 1 prediction (Propred1)137
CTL epitope prediction (CTLpred)42
Prediction of interferon-gamma inducing peptides (IFNepitope)102
Prediction of IL4 inducing peptides (IL4pred)133