Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID386006391
StrainMtb_RGTB423
Protein IDYP_005924670.1
Description biphenyl-2-3-diol 1-2-dioxygenase [Mycobacterium tuberculosis RGTB4
Sequence MSIRSLGYLRIEATDMAAWREYGLKVLGMVEGKGAPEGALYLRMDDFPAR
LVVVPGEHDRLLEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRR
VDEMIRFADPSGNCLEVFHGTALEHRRVVSPYGHRFVTGEQGMGHVVLST
RDDAEALHFYRDVLGFRLRDSMRLPPQMVGRPADGPPAWLRFFGCNPRHH
SLAFLPMPTSSGIVHLMVEVEQADDVGLCLDRALRRKVPMSATLGRHVND
LMLSFYMKTPGGFDIEFGCEGRQVDDRDWIARESTAVSLWGHDFTVGARG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)43
MHC class 1 prediction (Propred1)203
CTL epitope prediction (CTLpred)46
Prediction of interferon-gamma inducing peptides (IFNepitope)104
Prediction of IL4 inducing peptides (IL4pred)218