Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 392388206 |
Strain | Mtb_UT205 |
Protein ID | YP_005309835.1 |
Description | unnamed protein product [Mycobacterium tuberculosis UT205] |
Sequence | MTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVAITHGPYCSQ FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG LFT |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 15 |
MHC class II prediction (Propred) | 18 |
MHC class 1 prediction (Propred1) | 139 |
CTL epitope prediction (CTLpred) | 20 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
Prediction of IL4 inducing peptides (IL4pred) | 107 |