Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392388417
StrainMtb_UT205
Protein IDYP_005310046.1
Description mmpL8 [Mycobacterium tuberculosis UT205]
Sequence MCDVLMQPVRTPRPSTNLRSKPLRPTGDGGVFPRLGRLIVRRPWVVIAFW
VALAGLLAPTVPSLDAISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQS
VAVVVLSDAKGLGAADERSYKELVDALRRDTRDVVMLQDFVTTPPLRELM
TSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQVAGSTLTANLTGP
AATVADLNLTGQRDRSRIEFAITILLLVILLIIYGNPITMVLPLITIGMS
VVVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR
QGADSDQAVKKALTSIGKVIAASAATVAITFLGMVFTQLGILKTVGPMLG
ISVAVVFFAAVTLLPALMVLTGRRGWIAPRRDLTRRFWRSSGVHIVRRPK
THLLASALVLVILAGCAGLARYNYDDRKTLPASVESSIGYAALDKHFPSN
LIIPEYLFIQSSTDLRTPKALADLEQMVQRVSQVPGVAMVRGITRPAGRS
LEQARTSWQAGEVGSKLDEGSKQIAVHTGDIDKLAGGANLMASKLGDVRA
QVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID
ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGT
LAKISELARQLQATRAVQTLAATVSGLRGALATVIRAMGSLGMSSPGGVR
SKINLVNKGVNDLADGSRQLAEGVQLLVDQVKKMGFGLGEASAFLLAMKD
TATTPAMAGFYIPPELLSYATGESVKAETMPSEYRDLLGGLNVDQLKKVA
AAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNTALADAK
VSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVLLILIVLLRAIVAPLYLI
GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLI
SRLREEAVLGVRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQ
GAFVLGTGLLLDTFLVRTVTVPAIAVLVGQANWWLPSSWRPETWWPLGRR
RGRAQRTKRKPLLPKEEEEQSPPDDDDLIGLWLHDGLRL
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)78
MHC class II prediction (Propred)220
MHC class 1 prediction (Propred1)777
CTL epitope prediction (CTLpred)197
Prediction of interferon-gamma inducing peptides (IFNepitope)421
Prediction of IL4 inducing peptides (IL4pred)645