Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392388448
StrainMtb_UT205
Protein IDYP_005310077.1
Description ethA [Mycobacterium tuberculosis UT205]
Sequence MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKRESMGGTWDLFRY
PGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAMYGIDRHIRF
HHKVISADWSTAENRWTVHIQSHGTLSALTCEFLFLCSGYYNYDEGYSPR
FAGSEDFVGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAK
HVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVY
SACQKWPRRMRKMFLSLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGD
LFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFG
GATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSE
FVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQG
SRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)91
MHC class 1 prediction (Propred1)338
CTL epitope prediction (CTLpred)85
Prediction of interferon-gamma inducing peptides (IFNepitope)170
Prediction of IL4 inducing peptides (IL4pred)336