Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392388467
StrainMtb_UT205
Protein IDYP_005310096.1
Description esxB [Mycobacterium tuberculosis UT205]
Sequence MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTA
AQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF
B cell epitope (IEDB)26
T cell epitope (IEDB)280
MHC binder (IEDB)351
Vaccine TargetYes
B cell prediction (LBtope)12
MHC class II prediction (Propred)27
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)90
Prediction of IL4 inducing peptides (IL4pred)202