Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392431164
StrainMtb_KZN_605
Protein IDYP_006472208.1
Description alternative RNA polymerase sigma factor SigL [Mycobacterium tubercu
Sequence MARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLR
AWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPE
QSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGI
AEGTVKSRLHYAVRALRLTLQELGVTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)6
MHC class II prediction (Propred)24
MHC class 1 prediction (Propred1)123
CTL epitope prediction (CTLpred)40
Prediction of interferon-gamma inducing peptides (IFNepitope)94
Prediction of IL4 inducing peptides (IL4pred)85