Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392431735
StrainMtb_KZN_605
Protein IDYP_006472779.1
Description phiRv2 phage protein [Mycobacterium tuberculosis KZN 605]
Sequence MMADAVKYVVMCNCDDEPGALIIAWIDDERPAGGHIQMRSNTRFTETQWG
RHIEWKLECRACRKYAPISEMTAAAILDGFGAKLHELRTSTIPDADDPSI
AEARHVIPFSALCLRLSQLGG
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)7
MHC class II prediction (Propred)15
MHC class 1 prediction (Propred1)73
CTL epitope prediction (CTLpred)18
Prediction of interferon-gamma inducing peptides (IFNepitope)53
Prediction of IL4 inducing peptides (IL4pred)85