Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
| gene ID | 392432527 |
| Strain | Mtb_KZN_605 |
| Protein ID | YP_006473571.1 |
| Description | hypothetical protein TBXG_002084 [Mycobacterium tuberculosis KZN 60 |
| Sequence | MIRELVTTAAITGAAIGGAPVAGADPQRYDGDVPGMNYDASLGAPCSSWE RFIFGRGPSGQAEACHFPPPNQFPPAETGYWVISYPLYGVQQVGAPCPKP QAAAQSPDGLPMLCLGARGWQPGWFTGAGFFPPEP |
| B cell epitope (IEDB) | 0 |
| T cell epitope (IEDB) | 0 |
| MHC binder (IEDB) | 0 |
| Vaccine Target | Yes |
| B cell prediction (LBtope) | 2 |
| MHC class II prediction (Propred) | 13 |
| MHC class 1 prediction (Propred1) | 79 |
| CTL epitope prediction (CTLpred) | 9 |
| Prediction of interferon-gamma inducing peptides (IFNepitope) | 51 |
| Prediction of IL4 inducing peptides (IL4pred) | 95 |