Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392433863
StrainMtb_KZN_605
Protein IDYP_006474907.1
Description cyclase [Mycobacterium tuberculosis KZN 605]
Sequence METFRTLLAKAALGNGISSTAYDTAWVAKLGQLDDELSDLALNWLCERQL
PDGSWGAEFPFCYEDRLLSTLAAMISLTSNKHRRRRAAQVEKGLLALKNL
TSGAFEGPQLDIKDATVGFELIAPTLMAEAARLGLAICHEESILGELVGV
REQKLRKLGGSKINKHITAAFSVELAGQDGVGMLDVDNLQETNGSVKYSP
SASAYFALHVKPGDKRALAYISSIIQAGDGGAPAFYQAEIFEIVWSLWNL
SRTDIDLSDPEIVRTYLPYLDHVEQHWVRGRGVGWTGNSTLEDCDTTSVA
YDVLSKFGRSPDIGAVLQFEDADWFRTYFHEVGPSISTNVHVLGALKQAG
YDKCHPRVRKVLEFIRSSKEPGRFCWRDKWHRSAYYTTAHLICAASNYDD
ALCSDAIGWILNTQRPDGSWGFFDGQATAEETAYCIQALAHWQRHSGTSL
SAQISRAGGWLSQHCEPPYAPLWIAKTLYCSATVVKAAILSALRLVDESN
Q
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)33
MHC class II prediction (Propred)76
MHC class 1 prediction (Propred1)348
CTL epitope prediction (CTLpred)81
Prediction of interferon-gamma inducing peptides (IFNepitope)223
Prediction of IL4 inducing peptides (IL4pred)350