Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392434365
StrainMtb_KZN_605
Protein IDYP_006475410.1
Description hypothetical protein TBXG_003898 [Mycobacterium tuberculosis KZN 60
Sequence MSITRPTGSYARQMLDPGGWVEADEDTFYDRAQEYSQVLQRVTDVLDTCR
QQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAG
LIEQAKSDIGNNVDGAQREIDILENDPSLDADERHTAINSLVTATHGANV
SLVAETAERVLESKNWKPPKNALEDLLQQKSPPPPDVPTLVVPSPGTPGT
PGTPITPGTPITPGTPITPIPGAPVTPITPTPGTPVTPVTPGKPVTPVTP
VKPGTPGEPTPITPVTPPVAPATPATPATPVTPAPAPHPQPAPAPAPSPG
PQPVTPATPGPSGPATPGTPGGEPAPHVKPAALAEQPGVPGQHAGGGTQS
GPAHADESAASVTPAAASGVPGARAAAAAPSGTAVGAGARSSVGTAAASG
AGSHAATGRAPVATSDKAAAPSTRAASARTAPPARPPSTDHIDKPDRSES
ADDGTPVSMIPVSAARAARDAATAAASARQRGRGDALRLARRIAAALNAS
DNNAGDYGFFWITAVTTDGSIVVANSYGLAYIPDGMELPNKVYLASADHA
IPVDEIARCATYPVLAVQAWAAFHDMTLRAVIGTAEQLASSDPGVAKIVL
EPDDIPESGKMTGRSRLEVVDPSAAAQLADTTDQRLLDLLPPAPVDVNPP
GDERHMLWFELMKPMTSTATGREAAHLRAFRAYAAHSQEIALHQAHTATD
AAVQRVAVADWLYWQYVTGLLDRALAAAC
B cell epitope (IEDB)1
T cell epitope (IEDB)17
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)84
MHC class II prediction (Propred)51
MHC class 1 prediction (Propred1)449
CTL epitope prediction (CTLpred)90
Prediction of interferon-gamma inducing peptides (IFNepitope)326
Prediction of IL4 inducing peptides (IL4pred)451