Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392434368
StrainMtb_KZN_605
Protein IDYP_006475413.1
Description hypothetical protein TBXG_003901 [Mycobacterium tuberculosis KZN 60
Sequence MRNPLGLRFSTGHALLASALAPPCIIAFLETRYWWAGIALASLGVIVATV
TFYGRRITGWVAAVYAWLRRRRRPPDSSSEPVVGATVKPGDHVAVRWQGE
FLVAVIELIPRPFTPTVVVDGQAHTDDMLDTGLVEELLSVHCPDLEADIV
SAGYRVGNTAAPDVVSLYQQVIGTDPAPANRRTWIVLRADPERTRKSAQR
RDEGVAGLARYLVASATRIADRLASHGVDAVCGRSFDDYDHATDIGFVRE
KWSMIKGRDAYTAAYAAPGGPDVWWSARADHTITRVRVAPGMAPQSTVLL
TTADKPKTPRGFARLFGGQRPALQGQHLVANRHCQLPIGSAGVLVGETVN
RCPVYMPFDDVDIALNLGDAQTFTQFVVRAAAAGAMVTVGPQFEEFARLI
GAHIGQEVKVAWPNATTYLGPHPGIDRVILRHNVIGTPRHRQLPIRRVSP
PEESRYQMALPK
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)29
MHC class II prediction (Propred)71
MHC class 1 prediction (Propred1)322
CTL epitope prediction (CTLpred)78
Prediction of interferon-gamma inducing peptides (IFNepitope)209
Prediction of IL4 inducing peptides (IL4pred)313