Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID392434374
StrainMtb_KZN_605
Protein IDYP_006475419.1
Description hypothetical protein TBXG_003907 [Mycobacterium tuberculosis KZN 60
Sequence MTNPWNDPNMLDDGAIGRGDPSVRHHFRDSVSDTMRITDLAAPRKIPPGT
GWRKFVYSVSFHKINPGESPRERHYRNLQGRIRRHIRRQYVITVVSGKGG
VGVTTMAACIGGVFRECRPENVIAIDAVPSFGTLADRIDESPPGDYAAII
NDTDVQGYADIREHLGQNTVGLDVLAGNRTSDQPRPLVPAMFSAVLSRLR
RTHTVIVIDTSPDLEHDVMKAVLQSTDTLVFVSGITADRSRPVLRAVDYL
RAQGYHELVSRSTVILNHTDSITDKDALAYLTERFTKVGAIVEAMPFDPH
LAKGGIIDTVHELNKKSRLRLFEITAGLADKYVPDAERAAQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)4
Vaccine TargetYes
B cell prediction (LBtope)22
MHC class II prediction (Propred)40
MHC class 1 prediction (Propred1)230
CTL epitope prediction (CTLpred)63
Prediction of interferon-gamma inducing peptides (IFNepitope)141
Prediction of IL4 inducing peptides (IL4pred)238