Antigen Card |
The is the antigen card for every antigen and all its information available in our database.
gene ID | 395137049 |
Strain | Mtb_H37Rv_broad |
Protein ID | AFN48208.1 |
Description | MerR family transcriptional regulator- heat shock protein HspR [Mycobact |
Sequence | MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRY SLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELA VLRANQRREVAVVPKSTALVVWKPRR |
B cell epitope (IEDB) | 0 |
T cell epitope (IEDB) | 0 |
MHC binder (IEDB) | 0 |
Vaccine Target | Yes |
B cell prediction (LBtope) | 7 |
MHC class II prediction (Propred) | 19 |
MHC class 1 prediction (Propred1) | 87 |
CTL epitope prediction (CTLpred) | 27 |
Prediction of interferon-gamma inducing peptides (IFNepitope) | 38 |
Prediction of IL4 inducing peptides (IL4pred) | 61 |