Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395137713
StrainMtb_H37Rv_broad
Protein IDAFN48872.1
Description serine protease PepD [Mycobacterium tuberculosis H37Rv]
Sequence MAKLARVVGLVQEEQPSDMTNHPRYSPPPQQPGTPGYAQGQQQTYSQQFD
WRYPPSPPPQPTQYRQPYEALGGTRPGLIPGVIPTMTPPPGMVRQRPRAG
MLAIGAVTIAVVSAGIGGAAASLVGFNRAPAGPSGGPVAASAAPSIPAAN
MPPGSVEQVAAKVVPSVVMLETDLGRQSEEGSGIILSAEGLILTNNHVIA
AAAKPPLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTP
ISLGSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQN
TVLDAIQTDAAINPGNSGGALVNMNAQLVGVNSAIATLGADSADAQSGSI
GLGFAIPVDQAKRIADELISTGKASHASLGVQVTNDKDTLGAKIVEVVAG
GAAANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTFQDPSG
GSRTVQVTLGKAEQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)54
MHC class II prediction (Propred)46
MHC class 1 prediction (Propred1)271
CTL epitope prediction (CTLpred)51
Prediction of interferon-gamma inducing peptides (IFNepitope)223
Prediction of IL4 inducing peptides (IL4pred)245