Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395138272
StrainMtb_H37Rv_broad
Protein IDAFN49431.1
Description hypothetical protein RVBD_1515c [Mycobacterium tuberculosis H37Rv]
Sequence MSTNPGPAEGANQVMAQEHSAGAVQFTAHNVRLDDGTLTIPESSRTLDES
SWFISARGILETVFPGDKSHLRLADVGCLEGGYAVGFARMGFQVLGIEVR
ELNMAACNYIKSKTNLPNLRFVHDNALNIANHGLFDTVFCCGLFYHLENP
KQYLETLSSVTNKLLILQTHFSIINRSDKWLRLPTTARQLTDRLLRRPAP
VKFMLSAPTEHEGLPGRWFTEFSDDRSFGQRDTAKWASWDNRRSFWIQRE
HLLQAIKDVGVDLVMEEYDNLEPSIAESLLGGSYAANLRGTFIGIKTR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)49
MHC class 1 prediction (Propred1)205
CTL epitope prediction (CTLpred)53
Prediction of interferon-gamma inducing peptides (IFNepitope)91
Prediction of IL4 inducing peptides (IL4pred)192