Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395138285
StrainMtb_H37Rv_broad
Protein IDAFN49444.1
Description phthioceranic/hydroxyphthioceranic acid synthase [Mycobacterium tubercul
Sequence MGKERTKTVDRTRVTPVAVIGMGCRLPGGIDSPDRLWEALLRGDDLVTEI
PADRWDIDEYYDPEPGVPGRTDCKWGAYLDNVGDFDPEFFGIGEKEAIAI
DPQHRLLLETSWEAMEHGGLTPNQMASRTGVFVGLVHTDYILVHADNQTF
EGPYGNTGTNACFASGRVAYAMGLQGPAITVDTACSSGLTAIHLACRSLH
DGESDIALAGGVYVMLEPRRFASGSALGMLSATGRCHAFDVSADGFVSGE
GCVMLALKRLPDALADGDRILAVIRGTAANQDGHTVNIATPSRSAQVAAY
REALDVAGVDPATVGMVEAHGPGTPVGDPIEYASLAEVYGNDGPCALASV
KTNFGHTQSAAGALGLMKAVLALQHGVVPQNLHFTALPDKLAAIETNLFV
PQEITPWPGADQETPRRAAVSSYGMTGTNVHAIVEQAPVPAPESGAPGDT
PATPGIDGALLFALSASSQDALRQTAARLADWVDAQGPELAPADLAYTLA
RRRGHRPVRTAVLAATTAELTEALREVATGEPPYPPAVGQDDRGPVWVFS
GQGSQWAGMGADLLATEPVFAATIAAIEPLIAAESGFSVTEAMTAPEVVT
GIDRVQPTLFAMQVALAATMKSYGVAPGAVIGHSLGESAAAVVAGALCLE
DGVRVICRRSALMTRIAGAGAMASVELPAQQVLSELMARGVNDAVVAVVA
SPQSTVIGGATQTVRDLVAAWEQRDVLAREVAVDVASHSPQVDPILDELA
EALAEISPLQPEIPYYSATSFDPREEPYCDAYYWVDNLRHTVRFAAAVQA
ALEDGYRVFTELTPHPLLTHAVDQTARSLDMSAAALAGMRREQPLPHGLR
ALAGDLYAAGAAVDFAVLYPTGRLINAPLPTWNHRRLLLDDTTRRIAHAN
TVAVHPLLGSHVRLPEEPERHVWQGEVGTVTQPWLADHQIHGAAALPGAA
YCEMALAAARAVLGEASEVRDIRFEQMLLLDDETPIGVTATVEAPGVVPL
TVETSHDGRYTRQLAAVLHVVREADDAPDQPPQKNIAELLASHPHKVDGA
EVRQWLDKRGHRLGPAFAGLVDAYIAEGAGDTVLAEVNLPGPLRSQVKAY
GVHPVLLDACFQSVAAHPAVQGMADGGLLLPLGVRRLRSYGSARHARYCC
TTVTACGVGVEADLDVLDEHGAVVLAVRGLQLGTGASQASERARVLGERL
LSIEWHERELPENSHAEPGAWLLISTCDATDLVAAQLTDALKVHDAQCTT
MSWPQRADHAAQAARLRDQLGTGGFTGVFVLTAPQTGDPDAESPVRGGEL
VKHVVRIAREIPEITAQEPRLYVLTHNAQAVLSGDRPNLEQGGMRGLLRV
IGAEHPHLKASYVDVDEQTGAESVARQLLAASGEDETAWRNDQWYTARLC
PAPLRPEERQTTVVDHAEAGMRLQIRTPGDLQTLEFAAFDRVPPGPGEIE
VAVTASSINFADVLVTFGRYQTLDGRQPQLGTDFAGVVSAVGPGVSELKV
GDRVGGMSPNGCWATFVTCDARLATRLPEGLTDAQAAAVTTASATAWYGL
QDLARIKAGDKVLIHSATGGVGQAAIAIARAAGAQIYATAGNEKRRDLLR
DMGIEHVYDSRSVEFAEQIRRDTAGYGVDIVLNSVTGAAQLAGLKLLALG
GRFIEIGKRDIYSNTRLELLPFRRNLAFYGLDLGLMSVSHPAAVRELLST
VYRLTVEGVLPMPQSTHYPLAEAATAIRVMGAAEHTGKLILDVPHAGRSS
VVLPPEQARVFRSDGSYIITGGLGGLGLFLAEKMANAGAGRIVLSSRSQP
SQKALETIELVRAIGSDVVVECGDIAQPDTADRLVTAATATGLPLRGVLH
AAAVVEDATLANITDELIERDWAPKAYGAWQLHRATADQPLDWFCSFSSA
AALVGSPGQGAYAAANSWLDTFTHWRRAQDLPATSIAWGAWGQIGRAIAF
AEQTGDAIAPEEGAYAFETLLRHNRAYSGYAPVIGSPWLTAFAQHSPFAE
KFQSLGQNRSGTSKFLAELVDLPREEWPDRLRRLLSKQVGLILRRTIDTD
RLLSEYGLDSLSSQELRARVEAETGIRISATEINTTVRGLADLMCDKLAA
DRDAPAPA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)169
MHC class II prediction (Propred)278
MHC class 1 prediction (Propred1)1430
CTL epitope prediction (CTLpred)313
Prediction of interferon-gamma inducing peptides (IFNepitope)827
Prediction of IL4 inducing peptides (IL4pred)1400