Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID395140541
StrainMtb_H37Rv_broad
Protein IDAFN51700.1
Description bifunctional membrane-associated penicillin-binding protein 1A/1B ponA2
Sequence MPERLPAAITVLKLAGCCLLASVVATALTFPFAGGLGLMSNRASEVVANG
SAQLLEGQVPAVSTMVDAKGNTIAWLYSQRRFEVPSDKIANTMKLAIVSI
EDKRFADHSGVDWKGTLTGLAGYASGDLDTRGGSTLEQQYVKNYQLLVTA
QTDAEKRAAVETTPARKLREIRMALTLDKTFTKSEILTRYLNLVSFGNNS
FGVQDAAQTYFGINASDLNWQQAALLAGMVQSTSTLNPYTNPDGALARRN
VVLDTMIENLPGEAEALRAAKAEPLGVLPQPNELPRGCIAAGDRAFFCDY
VQEYLSRAGISKEQVATGGYLIRTTLDPEVQAPVKAAIDKYASPNLAGIS
SVMSVIKPGKDAHKVLAMASNRKYGLDLEAGETMRPQPFSLVGDGAGSIF
KIFTTAAALDMGMGINAQLDVPPRFQAKGLGSGGAKGCPKETWCVVNAGN
YRGSMNVTDALATSPNTAFAKLISQVGVGRAVDMAIKLGLRSYANPGTAR
DYNPDSNESLADFVKRQNLGSFTLGPIELNALELSNVAATLASGGVWCPP
NPIDQLIDRNGNEVAVTTETCDQVVPAGLANTLANAMSKDAVGSGTAAGS
AGAAGWDLPMSGKTGTTEAHRSAGFVGFTNRYAAANYIYDDSSSPTDLCS
GPLRHCGSGDLYGGNEPSRTWFAAMKPIANNFGEVQLPPTDPRYVDGAPG
SRVPSVAGLDVDAARQRLKDAGFQVADQTNSVNSSAKYGEVVGTSPSGQT
IPGSIVTIQISNGIPPAPPPPPLPEDGGPPPPVGSQVVEIPGLPPITIPL
LAPPPPAPPP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)71
MHC class II prediction (Propred)101
MHC class 1 prediction (Propred1)523
CTL epitope prediction (CTLpred)99
Prediction of interferon-gamma inducing peptides (IFNepitope)314
Prediction of IL4 inducing peptides (IL4pred)524